Antibodies

Jump to Filters
View as table Download
ASB3 Rabbit Polyclonal Antibody
TA349688

USD 380.00

In Stock

Rabbit Polyclonal Anti-ASB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ASB3
GPR75-ASB3 (N-term) Rabbit Polyclonal Antibody
AP50269PU-N

USD 580.00

2 Weeks

GPR75-ASB3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 14-42 amino acids from the N-terminal region of human ASB3
ASB3 Rabbit Polyclonal Antibody
TA344629

USD 539.00

5 Days

Rabbit Polyclonal Anti-ASB3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASB3 antibody: synthetic peptide directed towards the middle region of human ASB3. Synthetic peptide located within the following region: LEIRSSLKSERLRSDSYISQLPLPRSLHNYLLYEDVLRMYEVPELAAIQD