Rabbit Polyclonal antibody to PCMT1 (protein-L-isoaspartate (D-aspartate) O-methyltransferase)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 10 and 227 of PCMT1 |
PCMT1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 62-286 of human PCMT1 (NP_001238978.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-PCMT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCMT1 antibody: synthetic peptide directed towards the middle region of human PCMT1. Synthetic peptide located within the following region: APYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQD |
Germany
Japan
United Kingdom
China
