Antibodies

Jump to Filters
View as table Download
LDHAL6B Rabbit Polyclonal Antibody
TA335425

USD 539.00

5 Days

Rabbit Polyclonal Anti-LDHAL6B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LDHAL6B Antibody: synthetic peptide directed towards the middle region of human LDHAL6B. Synthetic peptide located within the following region: SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA
LDHAL6B Rabbit Polyclonal Antibody
TA362474

USD 539.00

5 Days

LDHAL6B Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LDHAL6B