P4HA2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
P4HA2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal OAT Antibody (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This OAT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-55 amino acids from the N-terminal region of human OAT. |
Rabbit Polyclonal Anti-GLUD1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF |
Rabbit Polyclonal Anti-CPS1 Antibody
Applications | IHC, WB |
Reactivities | Human, Pig |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the middle region of human CPS1. Synthetic peptide located within the following region: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI |
Rabbit Polyclonal Anti-GLUL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GLUL |
Rabbit Polyclonal Antibody against SAT1
Applications | IHC, WB |
Reactivities | Human, Mouse, Porcine, Xenopus, Hamster, Cow, Rat, Chicken |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region within residues 100-171 of the human protein. [Swiss-Prot# P21673] |
Anti-CKM Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 14-26 amino acids of Human creatine kinase, muscle |
Anti-AMD1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 298-310 amino acids of human adenosylmethionine decarboxylase 1 |
Anti-AMD1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 298-310 amino acids of human adenosylmethionine decarboxylase 1 |
Rabbit Polyclonal Anti-ASL Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ASL |
Rabbit Polyclonal Anti-NOS2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NOS2 |
Rabbit polyclonal anti-CKM / M-CK antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human M-CK. |
Anti-ODC1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human ornithine decarboxylase 1 |
Rabbit Polyclonal Anti-PYCR2 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PYCR2 antibody: synthetic peptide directed towards the middle region of human PYCR2. Synthetic peptide located within the following region: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE |
Rabbit Polyclonal Anti-GOT1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |