Antibodies

View as table Download

Rabbit Polyclonal antibody to Triosephosphate isomerase (triosephosphate isomerase 1)

Applications IF, IHC, WB
Reactivities Human (Predicted: Yeast, Dog, Chicken, Chimpanzee, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 187 and 249 of Triosephosphate isomerase (Uniprot ID#P60174)

Rabbit Polyclonal Antibody against ABCF2

Applications ICC/IF, Simple Western, WB
Reactivities Human, Yeast
Conjugation Unconjugated
Immunogen A fusion protein containing amino acids 1-102 of the ABCF2 protein.

Rabbit Polyclonal Anti-RHOC Antibody

Applications IHC, WB
Reactivities Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi
Conjugation Unconjugated
Immunogen The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF

swi6 (314-328) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Yeast
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding aa 314-328 of S.pombe Swi6 protein

GND1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Yeast
Conjugation Unconjugated
Immunogen 6-Phosphogluconic dehydrogenase isolated and purified from yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure.

Formate dehydrogenase rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Yeast
Conjugation Unconjugated
Immunogen Formate Dehydrogenase is isolated and purified from Yeast.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

GLO1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Yeast
Conjugation Unconjugated
Immunogen Glyoxalase isolated and purified from Yeast.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

CHK1 (312-327) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Yeast
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding aa 312-327 of S. cerevisiae CHK1

HIST4H4 (acetyl K5) rabbit polyclonal antibody, Serum

Applications ChIP, ELISA, IF, IP, WB
Reactivities Amphibian, Drosophila, Mammalian, Plant, Yeast
Conjugation Unconjugated
Immunogen Ovalbumin-conjugated peptide.

Rabbit Polyclonal Anti-Pst1 Antibody

Applications WB
Reactivities Yeast
Conjugation Unconjugated
Immunogen Pst1 antibody was raised against a synthetic peptide from the amino terminus of yeast Pst1.

Histone H2B (yeast) Rabbit polyclonal Antibody

Applications WB
Reactivities Yeast
Conjugation Unconjugated
Immunogen A synthesized peptide derived from yeast Histone H2B (yeast)

RAD9A rabbit polyclonal antibody, Purified

Applications ELISA, WB
Reactivities Yeast
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to aa 1125-1139 of yeast Rad9 protein conjugated to Keyhole Limpet Haemocyanin (KLH).

Rabbit Polyclonal Anti-SARS Spike Antibody

Reactivities Yeast
Conjugation Unconjugated
Immunogen SARS Spike antibody was raised against a synthetic peptide corresponding to amino acids at the amino-terminus of. The sARS Spike glycoprotein.