Antibodies

Jump to Filters
View as table Download
CARD8 Rabbit Polyclonal Antibody
TA349747

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-CARD8 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CARD8
CARD8 Rabbit Polyclonal Antibody
TA326822

USD 365.00

3 Weeks

CARD8 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CARD8
CARD8 Rabbit Polyclonal Antibody
TA334072

USD 539.00

5 Days

Rabbit Polyclonal Anti-CARD8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CARD8 Antibody is: synthetic peptide directed towards the N-terminal region of Human CARD8. Synthetic peptide located within the following region: LGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELID