CARD8 Rabbit Polyclonal Antibody

CAT#: TA334072

Rabbit Polyclonal Anti-CARD8 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of caspase recruitment domain family, member 8 (CARD8), transcript variant 1
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "CARD8"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CARD8 Antibody is: synthetic peptide directed towards the N-terminal region of Human CARD8. Synthetic peptide located within the following region: LGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELID
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 31 kDa
Gene Name caspase recruitment domain family member 8
Background The protein encoded by this gene belongs to the caspase recruitment domain (CARD)-containing family of proteins, which are involved in pathways leading to activation of caspases or nuclear factor kappa-B (NFKB). This protein may be a component of the inflammasome, a protein complex that plays a role in the activation of proinflammatory caspases. It is thought that this protein acts as an adaptor molecule that negatively regulates NFKB activation, CASP1-dependent IL1B secretion, and apoptosis. Polymorphisms in this gene may be associated with a susceptibility to rheumatoid arthritis. Alternatively spliced transcript variants have been described for this gene.
Synonyms CARDINAL; DACAR; DAKAR; NDPP; NDPP1; TUCAN
Note Immunogen sequence homology: Human: 100%
Reference Data
Protein Families Druggable Genome
Protein Pathways NOD-like receptor signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.