Antibodies

Jump to Filters
View as table Download
Acid sphingomyelinase (SMPD1) Rabbit Polyclonal Antibody
TA339053

USD 539.00

5 Days

Rabbit Polyclonal Anti-SMPD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMPD1 antibody: synthetic peptide directed towards the middle region of human SMPD1. Synthetic peptide located within the following region: INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV
Acid sphingomyelinase (SMPD1) Rabbit Polyclonal Antibody
TA355781

USD 539.00

5 Days

SMPD1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SMPD1