Antibodies

Jump to Filters
View as table Download
CCR8 Rabbit Polyclonal Antibody
TA321688

USD 380.00

2 Weeks

Anti-CCR8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 175-191 amino acids of Human chemokine (C-C motif) receptor 8
CCR8 Rabbit Polyclonal Antibody
TA321689

USD 380.00

4 Weeks

Anti-CCR8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 175-191 amino acids of Human C-C chemokine receptor type 8
CCR8 Rabbit Polyclonal Antibody
TA305990

USD 570.00

5 Days

Rabbit Polyclonal CCR8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen CCR8 antibody was raised against a peptide corresponding to amino acids 183 to 201 of human CCR8, which locate in the second extracellular loop.
CCR8 Rabbit Polyclonal Antibody
TA330415

USD 485.00

5 Days

Rabbit Polyclonal Anti-CCR8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCR8 antibody: synthetic peptide directed towards the middle region of human CCR8. Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT
CCR8 Rabbit Polyclonal Antibody
TA354442

USD 425.00

5 Days

Rabbit anti CCR8 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated