Antibodies

Jump to Filters
View as table Download
KCNK12 Rabbit Polyclonal Antibody
TA319968

USD 570.00

5 Days

Rabbit Polyclonal KCNK12 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KCNK12 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of human KCNK12.
KCNK12 Rabbit Polyclonal Antibody
TA315620

USD 380.00

In Stock

Rabbit polyclonal anti-KCNK12 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human KCNK12.
KCNK12 Rabbit Polyclonal Antibody
TA338708

USD 539.00

5 Days

Rabbit Polyclonal Anti-KCNK12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK12 antibody: synthetic peptide directed towards the middle region of human KCNK12. Synthetic peptide located within the following region: EGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGF