Rabbit Polyclonal EGLN3/PHD3 Antibody
| Applications | ChIP, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the C-terminus of humanPHD3/HIF Prolyl Hydroxylase 3. [LocusLink ID 112399] |
Rabbit Polyclonal HIF Prolyl Hydroxylase 3 Antibody
| Applications | ChIP, Electron Microscopy, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues between 50-100 of human Prolyl Hydroxylase Domain-Containing Protein 3 using the numbering given in entry NP_071356.1 (GeneID 112399). |
Goat Polyclonal Antibody against EGLN3
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RLGKYYVKERSK, from the internal region of the protein sequence according to NP_071356.1. |
Rabbit Polyclonal Anti-EGLN3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGLN3 antibody: synthetic peptide directed towards the C terminal of human EGLN3. Synthetic peptide located within the following region: FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT |
Germany
Japan
United Kingdom
China
