Antibodies

Jump to Filters
View as table Download
PSMC5 Rabbit Polyclonal Antibody
TA335803

USD 485.00

5 Days

Rabbit Polyclonal Anti-PSMC5 Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PSMC5 Antibody: synthetic peptide directed towards the C terminal of human PSMC5. Synthetic peptide located within the following region: AEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
PSMC5 Rabbit Polyclonal Antibody
TA327068

USD 365.00

3 Weeks

PSMC5 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSMC5