Antibodies

Jump to Filters
View as table Download
Retinoid X Receptor alpha (RXRA) Rabbit Polyclonal Antibody
TA332108

USD 539.00

5 Days

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI
LXR alpha (NR1H3) Rabbit Polyclonal Antibody
TA325122

USD 580.00

5 Days

Rabbit polyclonal NR1H3 Antibody (Center)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NR1H3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 226-253 amino acids from the Central region of human NR1H3.