Antibodies

Jump to Filters
View as table Download
Neuraminidase (NEU1) Mouse Monoclonal Antibody [Clone ID: OTI3D4]
TA801727

USD 447.00

In Stock

NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
GBA Mouse Monoclonal Antibody [Clone ID: OTI1D12]
TA803361

USD 447.00

In Stock

GBA mouse monoclonal antibody, clone OTI1D12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Neuraminidase (NEU1) Mouse Monoclonal Antibody [Clone ID: OTI3D4]
TA801727S

USD 200.00

In Stock

NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Neuraminidase (NEU1) Rabbit Polyclonal Antibody
TA335236

USD 485.00

2 Weeks

Rabbit Polyclonal Anti-NEU1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG
Neuraminidase (NEU1) Mouse Monoclonal Antibody [Clone ID: OTI3C4]
TA801668

USD 447.00

In Stock

NEU1 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications WB
Reactivities Human
Conjugation Unconjugated
GBA Rabbit Polyclonal Antibody
TA325083

USD 580.00

2 Weeks

Rabbit polyclonal GC Antibody (Center)

Applications FC, IHC, WB
Reactivities Human, Mouse (Predicted: Bovine, Pig)
Conjugation Unconjugated
Immunogen This GC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 337-365 amino acids from the Central region of human GC.