Antibodies

Jump to Filters
View as table Download
ERAS Rabbit Polyclonal Antibody
TA351164

USD 380.00

In Stock

Rabbit Polyclonal Anti-ERAS Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ERAS
ERAS Rabbit Polyclonal Antibody
TA312552

USD 380.00

In Stock

Rabbit polyclonal anti-ERAS antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ERAS.
Eras Rabbit Polyclonal Antibody
TA333411

USD 539.00

5 Days

Rabbit Polyclonal Anti-Eras Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Eras Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGV