Antibodies

Jump to Filters
View as table Download
B3GALTL (B3GLCT) Rabbit Polyclonal Antibody
TA316142

USD 380.00

4 Weeks

Rabbit polyclonal anti-B3GALTL antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human B3GALTL.
B3GALTL (B3GLCT) Rabbit Polyclonal Antibody
TA331017

USD 539.00

5 Days

Rabbit polyclonal Anti-B3GALTL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B3GALTL antibody: synthetic peptide directed towards the middle region of human B3GALTL. Synthetic peptide located within the following region: DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREE