Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 11 of 11 results

(reset)

VMAT2 (SLC18A2) Mouse Monoclonal Antibody [Clone ID: OTI9E11]

TA500506

USD 478.00

In Stock

Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI9E11 (formerly 9E11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

UBC6e (UBE2J1) Mouse Monoclonal Antibody [Clone ID: OTI3D1]

TA504988

USD 447.00

In Stock

UBE2J1 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications	FC, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

UBC6e (UBE2J1) Mouse Monoclonal Antibody [Clone ID: OTI3D1]

TA504988S

USD 200.00

2 Days

UBE2J1 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications	FC, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

VMAT2 (SLC18A2) Mouse Monoclonal Antibody [Clone ID: OTI9E11]

TA500506S

USD 200.00

In Stock

Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI9E11 (formerly 9E11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

VMAT2 (SLC18A2) Mouse Monoclonal Antibody [Clone ID: OTI10C11]

CF500463

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) SLC18A2 mouse monoclonal antibody, clone OTI10C11 (formerly 10C11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TRPC1 Rabbit Polyclonal Antibody

TA328677

USD 905.00

3 Weeks

Rabbit Polyclonal Anti-TRPC1

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide QLYDKGYTSKEQKDC, corresponding to amino acid residues 557-571 of human TRPC1.Intracellular.

1 / 2

2 / 2

Previous Next

Cytochrome b c1 complex subunit 9 (UQCR10) Rabbit Polyclonal Antibody

TA335305

USD 539.00

5 Days

Rabbit Polyclonal Anti-UCRC Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

1 / 2

2 / 2

Previous Next

Dopamine Transporter (SLC6A3) Goat Polyclonal Antibody

TA311170

USD 520.00

5 Days

Goat Anti-SLC6A3 / DAT Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-QLTSSTLTNPRQSP, from the internal region (near N Terminus) of the protein sequence according to NP_001035.1.

NDUFA4L2 Rabbit Polyclonal Antibody

TA315629

USD 380.00

In Stock

Rabbit polyclonal anti-NDUFA4L2 antibody

Applications	WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2.

VMAT2 (SLC18A2) Rabbit Polyclonal Antibody

TA309861

USD 625.00

In Stock

Rabbit Polyclonal VMAT2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A genomic peptide made to an internal region of the human VMAT2 protein (within residues 30-200). [Swiss-Prot Q05940]

Cytochrome C Oxidase subunit VIc (COX6C) Rabbit Polyclonal Antibody

TA347778

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-COX6C Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-COX6C Antibody: A synthesized peptide derived from human COX6C

1 - 11 of 11 results