Antibodies

View as table Download

NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-NEU1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG

NEU1 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications WB
Reactivities Human
Conjugation Unconjugated