Antibodies

Jump to Filters
View as table Download
Ribonuclease H2, subunit A (RNASEH2A) Rabbit Polyclonal Antibody
TA306706

USD 570.00

2 Weeks

Rabbit Polyclonal RNAse H2A Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen RNAse H2A antibody was raised against a 17 amino acid peptide near the center of human RNAse H2A.
PCNA Rabbit Polyclonal Antibody
TA590137

USD 482.00

In Stock

Rabbit Polyclonal PCNA Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
SSBP1 Rabbit Polyclonal Antibody
TA314569

USD 380.00

4 Weeks

Rabbit polyclonal anti-MtSSB antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MtSSB.
MCM3 Rabbit Polyclonal Antibody
TA313106

USD 380.00

2 Weeks

Rabbit polyclonal MCM3 (Thr722) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human MCM3 around the phosphorylation site of threonine 722.
Modifications Phospho-specific
MCM5 Rabbit Polyclonal Antibody
TA341689

USD 485.00

5 Days

Rabbit Polyclonal Anti-MCM5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM5 antibody: synthetic peptide directed towards the N terminal of human MCM5. Synthetic peptide located within the following region: MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG