Antibodies

Jump to Filters
View as table Download
POMT1 Rabbit Polyclonal Antibody
TA351547

USD 380.00

In Stock

Rabbit Polyclonal Anti-POMT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human POMT1
POMT1 (C-term) Rabbit Polyclonal Antibody
AP53389PU-N

USD 580.00

2 Weeks

POMT1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 706-735 amino acids from the C-terminal region of Human POMT1
POMT1 Rabbit Polyclonal Antibody
TA367201

USD 380.00

4 Weeks

POMT1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human POMT1
POMT1 Rabbit Polyclonal Antibody
TA335942

USD 539.00

5 Days

Rabbit Polyclonal Anti-POMT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-POMT1 Antibody: synthetic peptide directed towards the middle region of human POMT1. Synthetic peptide located within the following region: LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPL
POMT1 Rabbit Polyclonal Antibody
TA380159

USD 365.00

3 Weeks

POMT1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 310-550 of human POMT1 (NP_001070833.1).
Modifications Unmodified