Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
2 Weeks
ATG4B mouse monoclonal antibody,clone OTI1A3
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-ATG4B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-APG4B Antibody: synthetic peptide directed towards the C terminal of human APG4B. Synthetic peptide located within the following region: LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEIL |
Anti-APG4B Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 5-20 amino acids of Human Autophagy-related protein 4 homolog B |
Rabbit polyclonal anti-ATG4B antibody (Center)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Bovine, Chicken) |
| Conjugation | Unconjugated |
| Immunogen | This ATG4B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 250-290 amino acids from the Central region of human ATG4B. |
Rabbit Polyclonal Anti-ATG4B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATG4B Antibody: synthetic peptide directed towards the C terminal of human ATG4B. Synthetic peptide located within the following region: LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEIL |
Active filters
Category
- Antibodies
Target Symbol
- ATG4B