Antibodies

Jump to Filters
View as table Download
DNAJB14 Rabbit Polyclonal Antibody
TA336037

USD 539.00

5 Days

Rabbit Polyclonal Anti-DNAJB14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DNAJB14 Antibody is: synthetic peptide directed towards the N-terminal region of Human DNAJB14. Synthetic peptide located within the following region: SGDQSKPNCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKD
DNAJB14 Rabbit Polyclonal Antibody
TA375523

USD 365.00

3 Weeks

DNAJB14 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human DNAJB14 (NP_001026893.1).
Modifications Unmodified