Antibodies

View as table Download

Mouse Monoclonal beta-Actin Antibody (8H10D10)

Applications ELISA, FC, ICC/IF, Immunoblotting, WB
Reactivities Human, Mouse, Rat, Primate, Hamster
Conjugation Unconjugated

Rabbit Polyclonal beta-Actin Antibody

Applications Block/Neutralize, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Porcine, Avian, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709].

Rabbit Polyclonal Anti-KCNQ1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Hamster
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI

Mouse Monoclonal anti-KDELR1 Antibody

Applications IF, WB
Reactivities Human, Monkey, Rat, Mouse, Rabbit, Porcine, Bovine, Sheep, Dog, Chicken, Xenopus, Hamster, Drosophila
Conjugation Unconjugated

Rabbit Polyclonal Anti-KCNQ1 Antibody

Applications WB
Reactivities Human, Mouse, Hamster
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS

Mouse Monoclonal beta Actin Antibody

Applications WB
Reactivities Human, Monkey, Rat, Mouse, Goat, Hamster
Conjugation Unconjugated