Antibodies

Jump to Filters
View as table Download
ENPP7 Rabbit Polyclonal Antibody
TA322002

USD 380.00

In Stock

Anti-ENPP7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 290-305 amino acids of Human ectonucleotide pyrophosphatase/phosphodiesterase 7
ENPP7 Rabbit Polyclonal Antibody
TA322001

USD 380.00

In Stock

Anti-ENPP7 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 290-305 amino acids of Human ectonucleotide pyrophosphatase/phosphodiesterase 7
ENPP7 Rabbit Polyclonal Antibody
TA335354

USD 539.00

5 Days

Rabbit Polyclonal Anti-ENPP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENPP7 Antibody is: synthetic peptide directed towards the middle region of Human ENPP7. Synthetic peptide located within the following region: DLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRESIARNHLT
ENPP7 Rabbit Polyclonal Antibody
TA335355

USD 539.00

5 Days

Rabbit Polyclonal Anti-ENPP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENPP7 Antibody is: synthetic peptide directed towards the N-terminal region of Human ENPP7. Synthetic peptide located within the following region: WITAQRQGLRAGSFFYPGGNVTYQGVAVTRSRKEGIAHNYKNETEWRANI