Antibodies

Jump to Filters
View as table Download
GABARAPL2 (N-term) Rabbit Polyclonal Antibody
AP51787PU-N

USD 580.00

2 Weeks

GABARAPL2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GABARAPL2
GABARAPL2 Rabbit Polyclonal Antibody
TA340174

USD 539.00

5 Days

Rabbit Polyclonal Anti-GABARAPL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABARAPL2 antibody: synthetic peptide directed towards the N terminal of human GABARAPL2. Synthetic peptide located within the following region: KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV