Antibodies

Jump to Filters
View as table Download
COX15 Rabbit Polyclonal Antibody
TA339409

USD 485.00

5 Days

Rabbit Polyclonal Anti-COX15 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COX15 antibody: synthetic peptide directed towards the N terminal of human COX15. Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
COX15 Mouse Monoclonal Antibody [Clone ID: 6H2.B4]
TA328075

USD 410.00

5 Days

Mouse Monoclonal anti-Cytochrome c Antibody

Applications IF, IP
Reactivities Mouse, Rat, Human
Conjugation Unconjugated