Antibodies

Jump to Filters
View as table Download
TNFRSF1A Rabbit Polyclonal Antibody
TA328458

USD 314.00

In Stock

Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human sTNF Receptor Type I
TNFRSF1A Mouse Monoclonal Capture Antibody [Clone ID: TBP]
TA600021

USD 458.00

In Stock

TNFRSF1A mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700021
TNFRSF1A Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: H398]
TA700021

USD 494.00

In Stock

TNFRSF1A biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human
Conjugation Biotin
Matched ELISA Pair TA600021
TNFRSF1A (N-term) Rabbit Polyclonal Antibody
AP54311PU-N

USD 580.00

2 Weeks

TNFRSF1A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 24-52 amino acids from the N-terminal region of human TNFRSF1A
TNFRSF1A Rabbit Polyclonal Antibody
TA328457

USD 314.00

In Stock

Biotinylated Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Biotin
Immunogen E.coli derived Recombinant Human sTNF Receptor Type I
TNFRSF1A Rabbit Polyclonal Antibody
TA327070

USD 365.00

3 Weeks

Rabbit anti-TNF-R1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNF-R1
TNFRSF1A (195-211) Rabbit Polyclonal Antibody
AP23346PU-N

USD 560.00

2 Weeks

TNFRSF1A (195-211) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Goat, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequencein the middle region of Human TNFR1 (aa 195-211).
TNFRSF1A Rabbit Polyclonal Antibody
AP54307PU-N

USD 580.00

2 Weeks

TNFRSF1A rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 259-288 amino acids from human TNFR
TNFRSF1A Rabbit Polyclonal Antibody
TA330321

USD 539.00

5 Days

Rabbit Polyclonal Anti-TNFRSF1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI
TNFRSF1A Goat Polyclonal Antibody
TA311173

USD 520.00

5 Days

Goat Anti-TNFRSF1A Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Rat, Pig)
Conjugation Unconjugated
Immunogen Peptide with sequence C-SDHEIDRLELQNGR, from the internal region of the protein sequence according to NP_001056.1.
TNFRSF1A Rabbit Polyclonal Antibody
TA311833

USD 380.00

In Stock

Rabbit polyclonal TNF Receptor-1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human TNF receptor-1.
TNFRSF1A Rabbit Polyclonal Antibody
TA326458

USD 545.00

2 Weeks

Rabbit Polyclonal Anti-TNF-R1 Antibody

Reactivities Human, Mouse, Rat, Monkey, Bovine, Canine, Rabbit
Conjugation Unconjugated
Immunogen Peptide corresponding to AA 20-43 of the mouse TNF-R1 sequence, identical to rat and human over those residues