Antibodies

View as table Download

RAD51L1 mouse monoclonal antibody, clone OTI7H4 (formerly 7H4)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RAD51L1 mouse monoclonal antibody, clone OTI7H4 (formerly 7H4)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal anti-RAD51L1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAD51L1.

RAD51L1 mouse monoclonal antibody, clone OTI7H4 (formerly 7H4)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rad51L1 (RAD51B) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 201-250 of Human Rad51B.

Rabbit Polyclonal Anti-RAD51L1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD51L1 antibody: synthetic peptide directed towards the middle region of human RAD51L1. Synthetic peptide located within the following region: TESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRI

Mouse Monoclonal Rad51L1 Antibody (1 H3/13)

Applications ICC/IF, WB
Reactivities Human, Primate (Does not react with: Mouse)
Conjugation Unconjugated

Rabbit Polyclonal Anti-RAD51L1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD51L1 antibody: synthetic peptide directed towards the middle region of human RAD51L1. Synthetic peptide located within the following region: IPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTW

RAD51B Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RAD51L1