Antibodies

View as table Download

Rabbit polyclonal Cyclin H (Ab-315) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin H around the phosphorylation site of threonine 315 (E-W-TP-D-D).

Rabbit polyclonal Cyclin H (Thr315) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Cyclin H around the phosphorylation site of threonine 315 (E-W-TP-D-D)
Modifications Phospho-specific

Cyclin H (CCNH) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 267-299 amino acids from the C-terminal region of human CCNH

Cyclin H (CCNH) (N-term) rabbit polyclonal antibody, Purified

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 31-60 amino acids from the N-terminal region of human CCNH

Rabbit Polyclonal Anti-CCNH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNH antibody: synthetic peptide directed towards the C terminal of human CCNH. Synthetic peptide located within the following region: KQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL

Cyclin H mouse monoclonal antibody, clone AT3G6, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Cyclin H mouse monoclonal antibody, clone AT3G6, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

CCNH Rabbit Polyclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CCNH

Cyclin H (CCNH) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal anti-CCNH antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNH antibody: synthetic peptide directed towards the N terminal of human CCNH. Synthetic peptide located within the following region: PHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEY

Rabbit Polyclonal Anti-CCNH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNH antibody: synthetic peptide directed towards the middle region of human CCNH. Synthetic peptide located within the following region: KQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL

Rabbit Polyclonal Anti-Cyclin H Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cyclin H Antibody: A synthesized peptide derived from human Cyclin H

Mouse Monoclonal Cyclin H Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated