Antibodies

Jump to Filters
View as table Download
L2HGDH Rabbit Polyclonal Antibody
TA337982

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-L2HGDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-L2HGDH antibody is: synthetic peptide directed towards the middle region of Human L2HGDH. Synthetic peptide located within the following region: GSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAG
L2HGDH (Center) Rabbit Polyclonal Antibody
AP52435PU-N

USD 580.00

2 Weeks

L2HGDH (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 139-167aa) of human L2HGDH/Duranin.