Germany
Japan
United Kingdom
China
Antibodies
View as table Download
NUDT21 mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NUDT21 mouse monoclonal antibody, clone OTI13H1 (formerly 13H1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NUDT21 mouse monoclonal antibody, clone OTI5B3 (formerly 5B3)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NUDT21 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-NUDT21 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUDT21 antibody: synthetic peptide directed towards the N terminal of human NUDT21. Synthetic peptide located within the following region: TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV |
NUDT21 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-227 of human NUDT21 (NP_008937.1). |
| Modifications | Unmodified |
Active filters
Category
- Antibodies
Target Symbol
- NUDT21