Germany
Japan
United Kingdom
China
NUDT21 Rabbit Polyclonal Antibody
Product Images
USD 436.00
USD 200.00
USD 867.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | WB, IHC |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-NUDT21 antibody: synthetic peptide directed towards the N terminal of human NUDT21. Synthetic peptide located within the following region: TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 25 kDa |
| Gene Name | nudix hydrolase 21 |
| Database Link | |
| Background | NUDT21 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides. |
| Synonyms | CFIM25; CPSF5 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
Be the first one to submit a review
