Antibodies

Jump to Filters
View as table Download
PYCR1 Rabbit Monoclonal Antibody [Clone ID: OTIR1E8]
TA591038

USD 516.00

In Stock

Rabbit monoclonal anti-P5CR1 antibody for SISCAPA, clone OTIR1E8

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PYCR1 Rabbit Polyclonal Antibody
TA344624

USD 539.00

5 Days

Rabbit Polyclonal Anti-PYCR1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PYCR1 antibody: synthetic peptide directed towards the middle region of human PYCR1. Synthetic peptide located within the following region: RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE
PYCR1 Rabbit Polyclonal Antibody
TA344625

USD 539.00

5 Days

Rabbit Polyclonal Anti-PYCR1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PYCR1 antibody: synthetic peptide directed towards the middle region of human PYCR1. Synthetic peptide located within the following region: KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR
PYCR1 Rabbit Polyclonal Antibody
TA380585

USD 365.00

3 Weeks

PYCR1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-319 of human PYCR1 (NP_008838.2).
Modifications Unmodified
PYCR1 Rabbit Polyclonal Antibody
TA380586

USD 365.00

3 Weeks

PYCR1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-319 of human PYCR1 (NP_008838.2).
Modifications Unmodified