Rabbit Polyclonal Anti-GABARAP
| Applications | WB |
| Reactivities | Human, Insect, Cow, Dog, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
Rabbit anti AMPK-alpha(pT172) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Bovine, Chicken, Dog, Invertebrate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin |
Rabbit anti AMPK-alpha Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Bovine, Chicken, Dog, Invertebrate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin |
Germany
Japan
United Kingdom
China
