USD 580.00
5 Days
Rabbit polyclonal GIPR Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GIPR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-38 amino acids from the N-terminal region of human GIPR. |
USD 380.00
In Stock
USD 380.00
In Stock
Rabbit Polyclonal Anti-GIPR Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GIPR |
USD 539.00
5 Days
Rabbit Polyclonal Anti-GIPR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GIPR antibody is: synthetic peptide directed towards the N-terminal region of Human GIPR. Synthetic peptide located within the following region: LRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSVAA |
Germany
Japan
United Kingdom
China
