Antibodies

View as table Download

Rabbit Polyclonal Anti-CREB3L2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CREB3L2 antibody: synthetic peptide directed towards the N terminal of human CREB3L2. Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF

Rabbit polyclonal anti-CREB3L2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CREB3L2.

Rabbit polyclonal CREB3L2 Antibody (C-term)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CREB3L2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 490-517 amino acids from the C-terminal region of human CREB3L2.