Antibodies

Jump to Filters
View as table Download
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA306424

USD 570.00

In Stock

Rabbit Polyclonal Presenilin1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1.
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA313388

USD 380.00

In Stock

Rabbit polyclonal Presenilin 1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human presenilin 1.
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA334642

USD 539.00

5 Days

Rabbit Polyclonal Anti-PSEN1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PSEN1 antibody: synthetic peptide directed towards the N terminal of human PSEN1. Synthetic peptide located within the following region: TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA347463

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Presenilin 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Presenilin 1 Antibody: A synthesized peptide derived from human Presenilin 1
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA354271

USD 425.00

5 Days

Rabbit anti Presenillin Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated