Antibodies

Jump to Filters
View as table Download
OMA1 Rabbit Polyclonal Antibody
TA340395

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-OMA1 Antibody

Applications WB
Reactivities Human, Fish
Conjugation Unconjugated
Immunogen The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA
VIP Rabbit Polyclonal Antibody
AP09567SU-N

USD 755.00

2 Weeks

VIP rabbit polyclonal antibody, Serum

Applications IHC
Reactivities Feline, Fish, Human, Mammalian, Porcine, Rat
Conjugation Unconjugated
Immunogen Purified porcine VIP.