Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ELOVL5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELOVL5 antibody: synthetic peptide directed towards the N terminal of human ELOVL5. Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK |
Mouse anti-SCD1 (Stearoyl-CoA desaturase) monoclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
TA309938 is a replacement of AM20836PU-N.
Rabbit Polyclonal Anti-SCD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCD antibody: synthetic peptide directed towards the middle region of human SCD. Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG |
Rabbit polyclonal FADS2 Antibody (Center)
| Applications | FC, WB |
| Reactivities | Human (Predicted: Bovine, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This FADS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 96-122 amino acids from the Central region of human FADS2. |
Rabbit Polyclonal Anti-FADS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FADS1 antibody: synthetic peptide directed towards the C terminal of human FADS1. Synthetic peptide located within the following region: FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL |
Rabbit Polyclonal Anti-GPSN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPSN2 antibody: synthetic peptide directed towards the middle region of human GPSN2. Synthetic peptide located within the following region: PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR |
Goat Polyclonal Antibody against FADS1
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QPSFEPTKNKELTDE, from the internal region of the protein sequence according to NP_037534.2. |
Rabbit polyclonal anti-ELOVL2 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ELOVL2. |
Rabbit Polyclonal Anti-Hsd17b12 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hsd17b12 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hsd17b12. Synthetic peptide located within the following region: SAETFVKSAIKTVGLQTRTTGYVIHSLMGSINSIMPRWMYFKIIMGFSKS |
Rabbit Polyclonal Anti-FADS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FADS1 antibody: synthetic peptide directed towards the N terminal of human FADS1. Synthetic peptide located within the following region: RHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPSF |
Rabbit Polyclonal Anti-GPSN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPSN2 antibody: synthetic peptide directed towards the C terminal of human GPSN2. Synthetic peptide located within the following region: LRPAGSKTRKIPYPTKNPFTWLFLLVSCPNYTYEVGSWIGFAIMTQCLPV |
Active filters
Category
- Antibodies
Isotypes
- IgG
Families
- Transmembrane
Pathways
- Biosynthesis of unsaturated fatty acids