Antibodies

View as table Download

Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))

Applications FC, IF, WB
Reactivities Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106)

Anti-CCND1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-270 amino acids of Human Cyclin D1

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIAS2

Rabbit Polyclonal PIAS2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIAS2 antibody was raised against a 18 amino acid synthetic peptide near the amino terminus of human PIAS2.

Anti-CCND1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal MYC Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MYC

Rabbit polyclonal MYC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Myc.

Rabbit polyclonal anti-PIAS2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIAS2.

Rabbit Polyclonal C-myc antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human C-myc

Rabbit Polyclonal Anti-Pias2 Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Pias2 antibody: synthetic peptide directed towards the C terminal of mouse Pias2. Synthetic peptide located within the following region: LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE

Rabbit Polyclonal Cyclin D1 Antibody

Applications WB
Reactivities Mouse, Rat, Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Thr286.

Rabbit Polyclonal Cyclin D1 (Ser90) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Serine 90
Modifications Phospho-specific

Rabbit Polyclonal Myc (Thr58) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Myc around the phosphorylation site of Threonine 58
Modifications Phospho-specific

Goat Anti-PIAS2 Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence KEAMKVSSQPCTKIE, from the internal region of the protein sequence according to NP_775298.1; NP_004662.2.

Rabbit Polyclonal Cyclin D1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Cyclin D1