Anti-SERPINF1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 243 amino acids of human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 |
Rabbit Polyclonal Anti-SERPINF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPINF1 antibody: synthetic peptide directed towards the N terminal of human SERPINF1. Synthetic peptide located within the following region: GALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSN |
Anti-SERPINF1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 243 amino acids of human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 |
Rabbit anti-SERPINF1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SERPINF1 |
Goat Anti-SERPINF1 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KITGKPIKLTQVEHR, from the internal region of the protein sequence according to NP_002606.3. |
Germany
Japan
United Kingdom
China
