Rabbit Polyclonal Anti-NGF Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NGF |
Rabbit Polyclonal Anti-NGF Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NGF |
Rabbit polyclonal EGFR (Ab-1172) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
FGF23 Rabbit monoclonal antibody,clone OTIR5D11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-TGF Beta1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β1 antibody. |
Rabbit polyclonal anti-BDNF antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Anti-FGF7 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 179-182 amino acids of Human Fibroblast growth factor 7 |
Anti-NTF4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 25-210 amino acids of human neurotrophin 4 |
Anti-FGF3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 226-239 amino acids of Human fibroblast growth factor 3 |
Rabbit Polyclonal Anti-IL1A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IL1A |
Rabbit Polyclonal Anti-FGF18 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FGF18 |
Rabbit Polyclonal Anti-BDNF Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human, Macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Anti-FGF1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Fibroblast growth factor 1 |
Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human sTNF Receptor Type I |
Goat Polyclonal Antibody against FGF23
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RHTRSAEDDSERD, from the internal region of the protein sequence according to NP_065689.1. |
Goat Polyclonal Antibody against FGF21
Applications | ICC/IF, IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CQRPDGALYGSLH, from the internal region of the protein sequence according to NP_061986.1. |