Rabbit Polyclonal Anti-CACNB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPP |
Rabbit polyclonal Anti-CACNG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG1 antibody: synthetic peptide directed towards the N terminal of human CACNG1. Synthetic peptide located within the following region: SKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSL |
CACNB1 mouse monoclonal antibody,clone OTI3H6
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Mouse Monoclonal anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-CACNA2D4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNA2D4. |
Rabbit Polyclonal Anti-Cacng1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIIIGSICAFL |
Rabbit Polyclonal Anti-CACNG6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG6 antibody: synthetic peptide directed towards the N terminal of human CACNG6. Synthetic peptide located within the following region: MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGA |
CACNB1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 542-572 amino acids from the C-terminal region of human CACNB1 |
CACNB2 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 231-261 amino acids from the Central region of human CACNB2. |
CACNG4 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human CACNG4 |
Goat Polyclonal Antibody against CACNB4 (internal)
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DYPDSYQDTYKPH, from the internal region (near the C Terminus) of the protein sequence according to NP_001005747.1; NP_000717.2; NP_001005746.1. |
Goat Polyclonal Antibody against CACNA2D1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QEIFNKYNKDKKVR, from the internal region of the protein sequence according to NP_000713.2. |
Goat Anti-CACNB2 (aa565-579) Antibody
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence ECNKQRSRHKSKDRY, from the C Terminus of the protein sequence according to NP_000715.2; NP_963890.2; NP_963884.2; NP_963891.1; NP_963887.2; NP_963865.2; NP_963864.1; NP_963866.2; NP_001161417.1. |
Rabbit polyclonal anti-CACNG1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNG1. |
Rabbit polyclonal anti-CACNG7 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNG7. |
Germany
Japan
United Kingdom
China
