Antibodies

Jump to Filters
View as table Download
CXCR2 Rabbit Polyclonal Antibody
AP23279PU-N

USD 560.00

2 Weeks

CXCR2 rabbit polyclonal antibody, Aff - Purified

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide mapping at the middle region of human CXCR2
CXCR1 Rabbit Polyclonal Antibody
TA350645

USD 380.00

In Stock

Rabbit Polyclonal Anti-CXCR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CXCR1
CXCR2 Rabbit Polyclonal Antibody
TA311630

USD 380.00

In Stock

Rabbit polyclonal IL-8R beta/CDw128 beta (Ser347) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of serine 347 (R-P-SP-F-V).
Modifications Phospho-specific
CXCR2 Rabbit Polyclonal Antibody
TA325403

USD 380.00

4 Weeks

Rabbit Polyclonal IL-8R beta/CDw128 beta (Ser347) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of Serine 347
Modifications Phospho-specific
CXCR1 Goat Polyclonal Antibody
TA334182

USD 520.00

5 Days

Goat Anti-CXCR1 (aa26-38) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence DYSPCMLETETLN, from the internal region (near N terminus) of the protein sequence according to NP_000625.1.
CXCR2 Rabbit Polyclonal Antibody
TA346296

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL8RB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL8RB antibody: synthetic peptide directed towards the N terminal of human IL8RB. Synthetic peptide located within the following region: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF