Antibodies

View as table Download

HAND1 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HAND1 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HAND1 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10), Biotinylated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

HAND1 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

HAND1 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit polyclonal anti-HAND1 antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HAND1.

Rabbit Polyclonal Anti-HAND1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAND1 antibody: synthetic peptide directed towards the N terminal of human HAND1. Synthetic peptide located within the following region: CHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGR