Rabbit polyclonal antibody to PPA1 (pyrophosphatase (inorganic) 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 289 of PPA1 (Uniprot ID#Q15181) |
PPA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPA1 |
Rabbit Polyclonal Anti-PPA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPA1 antibody: synthetic peptide directed towards the N terminal of human PPA1. Synthetic peptide located within the following region: PRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT |
PPA1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PPA1 |
Germany
Japan
United Kingdom
China
