Antibodies

Jump to Filters
View as table Download
Methylmalonyl Coenzyme A mutase (MUT) Mouse Monoclonal Antibody [Clone ID: OTI2C8]
CF506873

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) MUT mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Methylmalonyl Coenzyme A mutase (MUT) Rabbit Polyclonal Antibody
TA335135

USD 539.00

5 Days

Rabbit polyclonal Anti-Mut Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mut antibody is: synthetic peptide directed towards the N-terminal region of Mouse Mut. Synthetic peptide located within the following region: LAKKQLKGKNPEDLIWHTPEGISIKPLYSRADTLDLPEELPGVKPFTRGP
Methylmalonyl Coenzyme A mutase (MUT) Rabbit Polyclonal Antibody
TA361875

USD 539.00

5 Days

MUT Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human MUT
Methylmalonyl Coenzyme A mutase (MUT) Mouse Monoclonal Antibody [Clone ID: OTI2C8]
TA506873S

USD 200.00

2 Days

MUT mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Methylmalonyl Coenzyme A mutase (MUT) Mouse Monoclonal Antibody [Clone ID: OTI2A8]
TA506883S

USD 200.00

In Stock

MUT mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".