Antibodies

Jump to Filters
View as table Download
Placental lactogen (CSH1) (C-term) Rabbit Polyclonal Antibody
AP51099PU-N

USD 580.00

2 Weeks

Placental lactogen (CSH1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 180-208 amino acids from the C-terminal region of human CSH1
Placental lactogen (CSH1) Rabbit Polyclonal Antibody
TA345768

USD 485.00

5 Days

Rabbit Polyclonal Anti-CSH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSH1 antibody: synthetic peptide directed towards the middle region of human CSH1. Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS
Placental lactogen (CSH1) Mouse Monoclonal Antibody [Clone ID: OTI1C9]
TA506814S

USD 200.00

2 Days

CSH1 mouse monoclonal antibody,clone OTI1C9

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Placental lactogen (CSH1) Rabbit Polyclonal Antibody
TA327692

USD 555.00

5 Days

Rabbit Polyclonal hPL Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Placental lactogen (CSH1) Mouse Monoclonal Antibody [Clone ID: OTI2A2]
TA506813S

USD 200.00

2 Days

CSH1 mouse monoclonal antibody, clone OTI2A2 (formerly 2A2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Placental lactogen (CSH1) Mouse Monoclonal Antibody [Clone ID: OTI4D6]
TA506816S

USD 200.00

2 Days

CSH1 mouse monoclonal antibody, clone OTI4D6 (formerly 4D6)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".