Antibodies

View as table Download

Rabbit Polyclonal Anti-BAZ1A Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human BAZ1A

Rabbit Polyclonal anti-BAZ1A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BAZ1A

Rabbit Polyclonal Anti-BAZ1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BAZ1A antibody: synthetic peptide directed towards the middle region of human BAZ1A. Synthetic peptide located within the following region: SLPKRGRPQVRLPVKTRGKLSSSFSSRGQQQEPGRYPSRSQQSTPKTTVS

BAZ1A Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1347-1556 of human BAZ1A (NP_038476.2).
Modifications Unmodified