BAZ1A Rabbit Polyclonal Antibody

CAT#: TA331197

Rabbit Polyclonal Anti-BAZ1A Antibody

Product Images

WB Suggested Anti-BAZ1A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BAZ1A antibody: synthetic peptide directed towards the middle region of human BAZ1A. Synthetic peptide located within the following region: SLPKRGRPQVRLPVKTRGKLSSSFSSRGQQQEPGRYPSRSQQSTPKTTVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 179 kDa
• Gene Name: bromodomain adjacent to zinc finger domain 1A
• Database Link:
  NP_038476
  Entrez Gene 11177 Human
  UniProt ID Q9NRL2
• Background: BAZ1A may play a role in transcriptional regulation. May be involved in the formation or maintenance of heterochromatin playing a critical role in developmental control.
• Synonyms: ACF1; hACF1; WALp1; WCRF180
• Note: Human: 100%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Dog: 85%; Pig: 85%; Horse: 85%; Bovine: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Druggable Genome