BAZ1A Rabbit Polyclonal Antibody

CAT#: TA331197

Reviews ()
Write a review

Rabbit Polyclonal Anti-BAZ1A Antibody



USD 396.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-BAZ1A antibody: synthetic peptide directed towards the middle region of human BAZ1A. Synthetic peptide located within the following region: SLPKRGRPQVRLPVKTRGKLSSSFSSRGQQQEPGRYPSRSQQSTPKTTVS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 179 kDa
Gene Name bromodomain adjacent to zinc finger domain 1A
Background BAZ1A may play a role in transcriptional regulation. May be involved in the formation or maintenance of heterochromatin playing a critical role in developmental control.
Synonyms ACF1; hACF1; WALp1; WCRF180
Note Human: 100%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Dog: 85%; Pig: 85%; Horse: 85%; Bovine: 85%; Guinea pig: 85%
Reference Data
Protein Families Druggable Genome
Other products for "BAZ1A"
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 186.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies